LOCUS NM_022267 1414 bp mRNA linear ROD 21-JUN-2025
DEFINITION Rattus norvegicus cyclin D2 (Ccnd2), mRNA.
ACCESSION NM_022267 XM_216276
VERSION NM_022267.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1414)
AUTHORS Qian,Y., Wang,J.W., Fang,Y., Yuan,X.D., Fan,Y.C., Gao,S. and
Wang,K.
TITLE Measurement of Cyclin D2 (CCND2) Gene Promoter Methylation in
Plasma and Peripheral Blood Mononuclear Cells and Alpha-Fetoprotein
Levels in Patients with Hepatitis B Virus-Associated Hepatocellular
Carcinoma
JOURNAL Med Sci Monit 26, e927444 (2020)
PUBMED 33320844
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1414)
AUTHORS Jin,M., Ren,J., Luo,M., You,Z., Fang,Y., Han,Y., Li,G. and Liu,H.
TITLE Long non-coding RNA JPX correlates with poor prognosis and tumor
progression in non-small-cell lung cancer by interacting with
miR-145-5p and CCND2
JOURNAL Carcinogenesis 41 (5), 634-645 (2020)
PUBMED 31253987
REFERENCE 3 (bases 1 to 1414)
AUTHORS Park,S.Y., Lee,C.J., Choi,J.H., Kim,J.H., Kim,J.W., Kim,J.Y. and
Nam,J.S.
TITLE The JAK2/STAT3/CCND2 Axis promotes colorectal Cancer stem cell
persistence and radioresistance
JOURNAL J Exp Clin Cancer Res 38 (1), 399 (2019)
PUBMED 31511084
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1414)
AUTHORS Anwar,S.L., Hasemeier,B., Schipper,E., Vogel,A., Kreipe,H. and
Lehmann,U.
TITLE LINE-1 hypomethylation in human hepatocellular carcinomas
correlates with shorter overall survival and CIMP phenotype
JOURNAL PLoS One 14 (5), e0216374 (2019)
PUBMED 31059558
REMARK Publication Status: Online-Only
REFERENCE 5 (bases 1 to 1414)
AUTHORS Hung,C.S., Wang,S.C., Yen,Y.T., Lee,T.H., Wen,W.C. and Lin,R.K.
TITLE Hypermethylation of CCND2 in Lung and Breast Cancer Is a Potential
Biomarker and Drug Target
JOURNAL Int J Mol Sci 19 (10), 3096 (2018)
PUBMED 30308939
REMARK Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1414)
AUTHORS Medema,R.H., Herrera,R.E., Lam,F. and Weinberg,R.A.
TITLE Growth suppression by p16ink4 requires functional retinoblastoma
protein
JOURNAL Proc Natl Acad Sci U S A 92 (14), 6289-6293 (1995)
PUBMED 7603984
REFERENCE 7 (bases 1 to 1414)
AUTHORS Hirai,H., Roussel,M.F., Kato,J.Y., Ashmun,R.A. and Sherr,C.J.
TITLE Novel INK4 proteins, p19 and p18, are specific inhibitors of the
cyclin D-dependent kinases CDK4 and CDK6
JOURNAL Mol Cell Biol 15 (5), 2672-2681 (1995)
PUBMED 7739547
REFERENCE 8 (bases 1 to 1414)
AUTHORS Wu,F., Buckley,S., Bui,K.C. and Warburton,D.
TITLE Differential expression of cyclin D2 and cdc2 genes in
proliferating and nonproliferating alveolar epithelial cells
JOURNAL Am J Respir Cell Mol Biol 12 (1), 95-103 (1995)
PUBMED 7811475
REFERENCE 9 (bases 1 to 1414)
AUTHORS Hosokawa,Y., Onga,T. and Nakashima,K.
TITLE Induction of D2 and D3 cyclin-encoding genes during promotion of
the G1/S transition by prolactin in rat Nb2 cells
JOURNAL Gene 147 (2), 249-252 (1994)
PUBMED 7926809
REFERENCE 10 (bases 1 to 1414)
AUTHORS Tamaru,T., Okada,M. and Nakagawa,H.
TITLE Differential expression of D type cyclins during neuronal
maturation
JOURNAL Neurosci Lett 168 (1-2), 229-232 (1994)
PUBMED 8028782
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from
JAXUCZ010000004.1.
On Nov 27, 2020 this sequence version replaced NM_022267.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: L09752.1, FQ234359.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN12840127 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-192 JAXUCZ010000004.1 161675231-161675422 c
193-408 JAXUCZ010000004.1 161673349-161673564 c
409-568 JAXUCZ010000004.1 161670771-161670930 c
569-717 JAXUCZ010000004.1 161663857-161664005 c
718-1414 JAXUCZ010000004.1 161653048-161653744 c
FEATURES Location/Qualifiers
source 1..1414
/organism=”Rattus norvegicus”
/mol_type=”mRNA”
/strain=”BN”
/db_xref=”taxon:10116″
/chromosome=”4″
/map=”4q42″
gene 1..1414
/gene=”Ccnd2″
/note=”cyclin D2″
/db_xref=”GeneID:64033″
/db_xref=”RGD:621083″
CDS 1..867
/gene=”Ccnd2″
/note=”vin-1 proto-oncogene”
/codon_start=1
/product=”G1/S-specific cyclin-D2″
/protein_id=”NP_071603.2″
/db_xref=”GeneID:64033″
/db_xref=”RGD:621083″
/translation=”MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFK
CVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGA
VCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIE
HILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEE
VNALTCDALTELLAKITHTDVDCLKACQEQIEAVLLNSLQQFRQEQHNGSKSVEDPDQ
ATTPTDVRDVDL”
misc_feature 790..864
/gene=”Ccnd2″
/note=”propagated from UniProtKB/Swiss-Prot (Q04827.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite”
misc_feature 808..810
/gene=”Ccnd2″
/note=”Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P30279; propagated from
UniProtKB/Swiss-Prot (Q04827.1); phosphorylation site”
misc_feature 835..837
/gene=”Ccnd2″
/note=”Phosphothreonine.
/evidence=ECO:0000250|UniProtKB:P30280; propagated from
UniProtKB/Swiss-Prot (Q04827.1); phosphorylation site”
exon 1..192
/gene=”Ccnd2″
/inference=”alignment:Splign:2.1.0″
exon 193..408
/gene=”Ccnd2″
/inference=”alignment:Splign:2.1.0″
exon 409..568
/gene=”Ccnd2″
/inference=”alignment:Splign:2.1.0″
exon 569..717
/gene=”Ccnd2″
/inference=”alignment:Splign:2.1.0″
exon 718..1414
/gene=”Ccnd2″
/inference=”alignment:Splign:2.1.0″
ORIGIN
1 atggagctgc tgtgctgtga ggtggacccg gtccgcaggg ccgtgccgga ccgcaacctg
61 ctggaagacc gcgtcctgca gaacctgttg actatcgagg agcgctacct cccgcagtgt
121 tcctatttca agtgcgtgca gaaggacatc cagccgtaca tgcgcaggat ggtggctacc
181 tggatgctag aggtctgtga ggaacagaag tgtgaagaag aggtctttcc tctggccatg
241 aattacctgg accgtttctt ggctggagtc ccgactccta agacccatct ccagctcctg
301 ggcgctgtgt gcatgttcct agcttccaag ctgaaagaga ccatcccgct gactgccgaa
361 aagctgtgta tttacaccga caattctgtg aaaccccagg agctgctgga gtgggaactg
421 gtggtgctgg gtaagctgaa gtggaacctg gctgcagtaa cccctcacga cttcattgag
481 cacatcctac gcaagctgcc ccagcagaag gagaagctgt ccctgatccg caagcatgcg
541 cagaccttca tcgctctgtg tgctaccgac ttcaagtttg ccatgtaccc gccatcgatg
601 atcgcaactg gaagcgtggg agcagccatc tgcgggcttc agcaggacga ggaagtgaat
661 gcactcacgt gcgatgccct gacggagctg ctggccaaga tcacccacac cgatgtggat
721 tgtctcaaag cctgccagga gcaaatcgag gctgtgctgc ttaacagcct tcagcagttc
781 cgtcaagagc agcacaacgg ctccaagtct gtggaagatc cggaccaagc caccacccct
841 acagacgtgc gggatgttga cctgtgagga agccattcgg gcggcaagag agaggcgtgt
901 tcgtcatctg ctagcccctt ctctctctct ctctagttat gtcttgttct tttgtgtttt
961 aggatgaaag ttcaaaacaa aaaacaaaaa caaaaacaaa aacaaaatct acccccacct
1021 agatcatatt taaaggtctt ttagaagtga gagggaaagg ccatatagtt gaggcacatg
1081 tggtacctgt tcaaagtcca gcagaaaggg atcccttgta tatgcgaacc attatcatgt
1141 gatgatgtaa gagttctagt gagatgctta caggagagcc ctcagactag ctagagaaca
1201 tgtatacctg cagtatggga acgaattaga ggagactgtc tcttgtgctt gggaactagt
1261 gcatatgccc cctttagtag aattgcaaga aaccatggat gccggtgcgg catgagtagt
1321 ttgcaaagca ttgaacccaa gaaggaatca gaaatgagaa gggacacgct ggggaggtta
1381 tgcagaacca cccaaccaca cgactgaacc attt
//
